(data stored in ACNUC30630 zone)

EMBL: CP001275.PE374

CP001275.PE374       Location/Qualifiers
FT   CDS             385014..385484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0384"
FT                   /product="NifU family protein"
FT                   /note="identified by match to protein family HMM PF01592"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05779"
FT                   /db_xref="GOA:B9KY40"
FT                   /db_xref="InterPro:IPR002871"
FT                   /db_xref="UniProtKB/TrEMBL:B9KY40"
FT                   /protein_id="ACM05779.1"
FT                   /translation="MEQIVEHYRRPRHRHALPDADVVMPGGNPGCGDIVTIYLKVDEQG
FT                   HLIAEASFEGEGCTISQAAADILLDVVNEERWTLEQVLEADYHLMEELIGEEAVKLRPR
FT                   CATLALGTLKAAVTKYLRDQLRREAGLEVVERENERFGIVTGELPSAEASHS"
     MEQIVEHYRR PRHRHALPDA DVVMPGGNPG CGDIVTIYLK VDEQGHLIAE ASFEGEGCTI        60
     SQAAADILLD VVNEERWTLE QVLEADYHLM EELIGEEAVK LRPRCATLAL GTLKAAVTKY       120
     LRDQLRREAG LEVVERENER FGIVTGELPS AEASHS                                 156
//

If you have problems or comments...

PBIL Back to PBIL home page