(data stored in ACNUC30630 zone)

EMBL: CP001275.PE376

CP001275.PE376       Location/Qualifiers
FT   CDS             complement(385915..386487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0385"
FT                   /product="putative DNA polymerase III, epsilon chain (EC )"
FT                   /EC_number="2.7.7.7"
FT                   /note="identified by match to protein family HMM PF00929"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05484"
FT                   /db_xref="GOA:B9KY42"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:B9KY42"
FT                   /protein_id="ACM05484.1"
FT                   /translation="MDRRRCAQAWARAICSSSGVVILDTETTGIRSQDQVIELAVLDTH
FT                   GNVLLETLVKPSCPIDPAALRVHGLSEAHLAHAPEWPVVYRELRVIFDRARLIVTYNAP
FT                   FDRRLIEQTCRCYGLSLPDLSWDCAMRRFAEYAGPPPTESWRNYHRLSEALQRLGIPHP
FT                   GAHRAAADAEACRRLVRAMAAGQPLRF"
     MDRRRCAQAW ARAICSSSGV VILDTETTGI RSQDQVIELA VLDTHGNVLL ETLVKPSCPI        60
     DPAALRVHGL SEAHLAHAPE WPVVYRELRV IFDRARLIVT YNAPFDRRLI EQTCRCYGLS       120
     LPDLSWDCAM RRFAEYAGPP PTESWRNYHR LSEALQRLGI PHPGAHRAAA DAEACRRLVR       180
     AMAAGQPLRF                                                              190
//

If you have problems or comments...

PBIL Back to PBIL home page