(data stored in ACNUC30630 zone)

EMBL: CP001275.PE385

CP001275.PE385       Location/Qualifiers
FT   CDS             394307..396139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0394"
FT                   /product="putative ABC transporter, substrate binding
FT                   protein (oligopeptide)"
FT                   /note="identified by match to protein family HMM PF00496"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04538"
FT                   /db_xref="GOA:B9KY51"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:B9KY51"
FT                   /protein_id="ACM04538.1"
FT                   /translation="MHVRNEVHRAMSAVSQDRRVWLLEDVRCEMKRGRIRALLRLVSVL
FT                   ALALPILAACARGQATPTPAPSGATPTAGQTPAAVSSPTQAAVTTPTGEKVLRIHEYTY
FT                   PDVFDPQKSSFSNEIAVLHMNYEGLTRLDKDLNTVPAAAESWEFNQDGTVVTFHLRAGL
FT                   KYSDGTPLTAERFRYAVERTCDPKTAGEYQSILFDIVGCEEFAGTDPNDQAAYEAARQK
FT                   LGVEAPDDRTLIVRLTHPAPYFPTIASLWVFYPARKELIEQGGENWWKDPKLQIGNGPF
FT                   QMVEVVEDQRIRFVANTNYWEGRPKLDAVEIIYQKESSVALEAYKAGQLDMFSPDPSQL
FT                   PAIKSDPELSKQLVTYPAATTIQLSFNLTKEPFTDKKVREAFAYAFDRKTYCEQIRNGD
FT                   CTPTLEWIPPGIPGHIGTDKYGFDPAKAKQALAESKYGGPDKLPEIKLTFNSDDPAARP
FT                   RVEWIAGQYRDILGVNITLEPVDGKTLVAMRKDPSTYPQMTMAGWIQDYPDPQNWLSVY
FT                   WKCDATFAQRFGYCNKQFDELVTKADQELDQQKRIELYKQAHQILIDDVPGPFLYNPLN
FT                   IWLVKPSVTGYSPTPSDDAFPGEFASLMTLDIKK"
     MHVRNEVHRA MSAVSQDRRV WLLEDVRCEM KRGRIRALLR LVSVLALALP ILAACARGQA        60
     TPTPAPSGAT PTAGQTPAAV SSPTQAAVTT PTGEKVLRIH EYTYPDVFDP QKSSFSNEIA       120
     VLHMNYEGLT RLDKDLNTVP AAAESWEFNQ DGTVVTFHLR AGLKYSDGTP LTAERFRYAV       180
     ERTCDPKTAG EYQSILFDIV GCEEFAGTDP NDQAAYEAAR QKLGVEAPDD RTLIVRLTHP       240
     APYFPTIASL WVFYPARKEL IEQGGENWWK DPKLQIGNGP FQMVEVVEDQ RIRFVANTNY       300
     WEGRPKLDAV EIIYQKESSV ALEAYKAGQL DMFSPDPSQL PAIKSDPELS KQLVTYPAAT       360
     TIQLSFNLTK EPFTDKKVRE AFAYAFDRKT YCEQIRNGDC TPTLEWIPPG IPGHIGTDKY       420
     GFDPAKAKQA LAESKYGGPD KLPEIKLTFN SDDPAARPRV EWIAGQYRDI LGVNITLEPV       480
     DGKTLVAMRK DPSTYPQMTM AGWIQDYPDP QNWLSVYWKC DATFAQRFGY CNKQFDELVT       540
     KADQELDQQK RIELYKQAHQ ILIDDVPGPF LYNPLNIWLV KPSVTGYSPT PSDDAFPGEF       600
     ASLMTLDIKK                                                              610
//

If you have problems or comments...

PBIL Back to PBIL home page