(data stored in ACNUC30630 zone)

EMBL: CP001275.PE400

CP001275.PE400       Location/Qualifiers
FT   CDS             complement(408977..409597)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0409"
FT                   /product="putative SCO1/SenC family protein"
FT                   /note="identified by match to protein family HMM PF00578;
FT                   match to protein family HMM PF02630"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ACM06113"
FT                   /db_xref="GOA:B9KY66"
FT                   /db_xref="InterPro:IPR003782"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B9KY66"
FT                   /protein_id="ACM06113.1"
FT                   /translation="MPTRPWLRRLVVAELAAIAIVLAVVGWYVWQSRAAPSLNGMLLDP
FT                   PQEIPAIQLTGSDGQPHALTDFQGKVTVVFFGYTHCPDVCPMTASTMARARAMLGNQAD
FT                   RVQLVFVSVDPERDSPERLASYLAKYDPTFLGLTGDEDRIRELATVFGVHYAKVESTSA
FT                   LGYLVEHTSSSFVLDTQGKLRAVLPFGLTPEQVASDLRALLRR"
     MPTRPWLRRL VVAELAAIAI VLAVVGWYVW QSRAAPSLNG MLLDPPQEIP AIQLTGSDGQ        60
     PHALTDFQGK VTVVFFGYTH CPDVCPMTAS TMARARAMLG NQADRVQLVF VSVDPERDSP       120
     ERLASYLAKY DPTFLGLTGD EDRIRELATV FGVHYAKVES TSALGYLVEH TSSSFVLDTQ       180
     GKLRAVLPFG LTPEQVASDL RALLRR                                            206
//

If you have problems or comments...

PBIL Back to PBIL home page