(data stored in ACNUC30630 zone)

EMBL: CP001275.PE420

CP001275.PE420       Location/Qualifiers
FT   CDS             427750..428031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0431"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05254"
FT                   /db_xref="UniProtKB/TrEMBL:B9KY86"
FT                   /protein_id="ACM05254.1"
FT                   /translation="MSEPEQHELYQLLLAMDVLEELLEDLEESGLTSLEDLASRLASDA
FT                   EATDLLELIAQLIARGIRTSEDLAGFLSELEQRIEEPEVMDSDWVNPN"
     MSEPEQHELY QLLLAMDVLE ELLEDLEESG LTSLEDLASR LASDAEATDL LELIAQLIAR        60
     GIRTSEDLAG FLSELEQRIE EPEVMDSDWV NPN                                     93
//

If you have problems or comments...

PBIL Back to PBIL home page