(data stored in ACNUC30630 zone)

EMBL: CP001275.PE438

CP001275.PE438       Location/Qualifiers
FT   CDS             446227..447270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroF"
FT                   /locus_tag="trd_0449"
FT                   /product="phospho-2-dehydro-3-deoxyheptonate aldolase"
FT                   /EC_number="2.5.1.54"
FT                   /note="identified by match to protein family HMM PF00793;
FT                   match to protein family HMM TIGR01361"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05568"
FT                   /db_xref="GOA:B9KYA4"
FT                   /db_xref="InterPro:IPR006218"
FT                   /db_xref="InterPro:IPR006268"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYA4"
FT                   /protein_id="ACM05568.1"
FT                   /translation="MGREDRAMIVRLRPETDEQESEALAAALRRAGLDVTLLTLGGTPL
FT                   LSVNGRAVPPEVEQELLRHPAVEKLLRPDRPYCLAARSSRPDGTVVRVGPVEIGAKQPV
FT                   IIAGPCTVENRDQLLRIAEAVRDAGASMLRGGAFKPRTSPYSFQGLGERGLELLAEARE
FT                   ETGLPIVTEVLDTEQVELVARYADMLQIGSRNMMNFALLRKVAATGKPVLLKRGFAATI
FT                   EEWLLAAEYLLAGGNDQVVLCERGVRSFEPATRFMLDLNAVPLVRQLSHLPIIVDPSHG
FT                   TGLRELVPPMSFAAIAAGAHGIIVEVHTSPEAALVDGRQSIDPTTLASIVRRVRMLRDM
FT                   VEELVAV"
     MGREDRAMIV RLRPETDEQE SEALAAALRR AGLDVTLLTL GGTPLLSVNG RAVPPEVEQE        60
     LLRHPAVEKL LRPDRPYCLA ARSSRPDGTV VRVGPVEIGA KQPVIIAGPC TVENRDQLLR       120
     IAEAVRDAGA SMLRGGAFKP RTSPYSFQGL GERGLELLAE AREETGLPIV TEVLDTEQVE       180
     LVARYADMLQ IGSRNMMNFA LLRKVAATGK PVLLKRGFAA TIEEWLLAAE YLLAGGNDQV       240
     VLCERGVRSF EPATRFMLDL NAVPLVRQLS HLPIIVDPSH GTGLRELVPP MSFAAIAAGA       300
     HGIIVEVHTS PEAALVDGRQ SIDPTTLASI VRRVRMLRDM VEELVAV                     347
//

If you have problems or comments...

PBIL Back to PBIL home page