(data stored in ACNUC30630 zone)

EMBL: CP001275.PE439

CP001275.PE439       Location/Qualifiers
FT   CDS             complement(447272..448252)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0450"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ACM06214"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYA5"
FT                   /protein_id="ACM06214.1"
FT                   /translation="MSAQSSPLWPLLERALAQLYPGRRVRLVRMSAQPHVHRGFWHLEA
FT                   HLSPTHEQLAFAVLVLDREGTDRAAPERYAAVAANALPAPVLLATAADPDRLVLLFQVP
FT                   QGTNLDDELRRAAAPWRVSAAAISLARFFARLHSTPVHAFEPITTLQPASPTDEQRLSQ
FT                   LAAMAHDFDDPLRSSVERALDWIDQELDHSPALVPTVGCLRLPTLYEDSGEIATAFCWE
FT                   HLALRPAAVDLACLLPELRFLPAEGRAHFLAVCLAAYADVAPVAIDDVAPRALLDLIER
FT                   VLIVQSARASAATTSRDRAPDQEAVAFLDRAMRAARDGLPALALL"
     MSAQSSPLWP LLERALAQLY PGRRVRLVRM SAQPHVHRGF WHLEAHLSPT HEQLAFAVLV        60
     LDREGTDRAA PERYAAVAAN ALPAPVLLAT AADPDRLVLL FQVPQGTNLD DELRRAAAPW       120
     RVSAAAISLA RFFARLHSTP VHAFEPITTL QPASPTDEQR LSQLAAMAHD FDDPLRSSVE       180
     RALDWIDQEL DHSPALVPTV GCLRLPTLYE DSGEIATAFC WEHLALRPAA VDLACLLPEL       240
     RFLPAEGRAH FLAVCLAAYA DVAPVAIDDV APRALLDLIE RVLIVQSARA SAATTSRDRA       300
     PDQEAVAFLD RAMRAARDGL PALALL                                            326
//

If you have problems or comments...

PBIL Back to PBIL home page