(data stored in ACNUC30630 zone)

EMBL: CP001275.PE444

CP001275.PE444       Location/Qualifiers
FT   CDS             451014..451928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0455"
FT                   /product="malyl-CoA lyase"
FT                   /note="identified by match to protein family HMM PF03328"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04753"
FT                   /db_xref="GOA:B9KYB0"
FT                   /db_xref="InterPro:IPR005000"
FT                   /db_xref="InterPro:IPR011206"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYB0"
FT                   /protein_id="ACM04753.1"
FT                   /translation="MHPERSVLSVPGGRPELFEKALRSDADLVFLDLEDSVVETAKAEA
FT                   RRNVVRAVNELDWRGRPRAVRINAVDSPYCYRDLMDLLEGAGNRIDLIIVPKVERPEQV
FT                   HALDILLDQLEAAGGIGHRVQLEVQLETASGILHAGSIAGACERLRALVFGPGDYAASV
FT                   GMPMSAIGMEDEWDAAYGAPRLQYPMHQLLVAARAYGLRAIDGPYADYRDNEGLRRAAR
FT                   RARALGYDGKWCIHPAQIPIVNEVFTPTEAEIAWAKEVLKAYHEAERQRRGALAIGSTM
FT                   IDAASVRMAESTLSRARAAGRGF"
     MHPERSVLSV PGGRPELFEK ALRSDADLVF LDLEDSVVET AKAEARRNVV RAVNELDWRG        60
     RPRAVRINAV DSPYCYRDLM DLLEGAGNRI DLIIVPKVER PEQVHALDIL LDQLEAAGGI       120
     GHRVQLEVQL ETASGILHAG SIAGACERLR ALVFGPGDYA ASVGMPMSAI GMEDEWDAAY       180
     GAPRLQYPMH QLLVAARAYG LRAIDGPYAD YRDNEGLRRA ARRARALGYD GKWCIHPAQI       240
     PIVNEVFTPT EAEIAWAKEV LKAYHEAERQ RRGALAIGST MIDAASVRMA ESTLSRARAA       300
     GRGF                                                                    304
//

If you have problems or comments...

PBIL Back to PBIL home page