(data stored in ACNUC30630 zone)

EMBL: CP001275.PE464

CP001275.PE464       Location/Qualifiers
FT   CDS             complement(472399..473826)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0475"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05537"
FT                   /db_xref="InterPro:IPR003646"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYD0"
FT                   /protein_id="ACM05537.1"
FT                   /translation="MRERTRPFLHCVCAVLLLIMLPIQSVRAVSTLTVGQPATVMGTNG
FT                   DGLNLREGPGYDFTVIVVMPEGATVRVIGGPQPDARGNLWWNVQWGEKSGWALANYLAP
FT                   SNDENRPSSSFQMRATFRIFAHSLGLVGERTANGHVIQPNDFFVTLPCTCALSSRGGHE
FT                   FQVLVEYKGRSLVLPVWDVGPWNVDDDFWNPPEVRRWKGLPQGVPAAQAAYFHGYNGGK
FT                   DGWGRPVRSPAAMDIADGAFAALGMTQSDWVTVTFLWLVKDPPSPLPAPPRGYEEIVTV
FT                   HPGERPPLDPVAAADPARYIYMPETGHNVPVFLHTAWQQGGGWQRYGLPISEFFREVGI
FT                   DGTVRFVQYFERAVLLYDPASGNVSELPVGYYAAAPFEAWQPVELFPDSTDRLYFRETR
FT                   HSLSNGFKAYWSANGGRAVFGLPITEEFRVDLPDGRWYIAQLFERARLEWWPDRIGQPD
FT                   EITRGRIVAEIVAAQYP"
     MRERTRPFLH CVCAVLLLIM LPIQSVRAVS TLTVGQPATV MGTNGDGLNL REGPGYDFTV        60
     IVVMPEGATV RVIGGPQPDA RGNLWWNVQW GEKSGWALAN YLAPSNDENR PSSSFQMRAT       120
     FRIFAHSLGL VGERTANGHV IQPNDFFVTL PCTCALSSRG GHEFQVLVEY KGRSLVLPVW       180
     DVGPWNVDDD FWNPPEVRRW KGLPQGVPAA QAAYFHGYNG GKDGWGRPVR SPAAMDIADG       240
     AFAALGMTQS DWVTVTFLWL VKDPPSPLPA PPRGYEEIVT VHPGERPPLD PVAAADPARY       300
     IYMPETGHNV PVFLHTAWQQ GGGWQRYGLP ISEFFREVGI DGTVRFVQYF ERAVLLYDPA       360
     SGNVSELPVG YYAAAPFEAW QPVELFPDST DRLYFRETRH SLSNGFKAYW SANGGRAVFG       420
     LPITEEFRVD LPDGRWYIAQ LFERARLEWW PDRIGQPDEI TRGRIVAEIV AAQYP            475
//

If you have problems or comments...

PBIL Back to PBIL home page