(data stored in ACNUC30630 zone)

EMBL: CP001275.PE466

CP001275.PE466       Location/Qualifiers
FT   CDS             475001..475963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0477"
FT                   /product="Transketolase, pyridine binding domain protein"
FT                   /note="identified by match to protein family HMM PF02779;
FT                   match to protein family HMM PF02780"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05738"
FT                   /db_xref="GOA:B9KYD2"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYD2"
FT                   /protein_id="ACM05738.1"
FT                   /translation="MNIGTRAGLRMGKATRDAFGEALRDLGGVYPDLVVVDGDVSNSTR
FT                   TEYFAQAFPQRFFNVGIAESNLIGVASGLAASGKRVVAASFACFLLCNAFDQIRMGVAY
FT                   PRLNVKLVGSHAGISIGEDGPSQMGIEDVALALSLPGVAVLVPADEHATRAATRAMLEW
FT                   EGPTYLRLGRPPVPVIYEPPVDFVIGRAFRLREGNDVTIIANGLMVAMALDAAEELAAR
FT                   GVQARVLDMATVRPLDVDAVIAAARETRGIVVAEEHLHYGGLGSVVAMAVSQHHPCPMR
FT                   FVDLDDRYAESGAPDDLLRAYGLTSERIVAAALELTERI"
     MNIGTRAGLR MGKATRDAFG EALRDLGGVY PDLVVVDGDV SNSTRTEYFA QAFPQRFFNV        60
     GIAESNLIGV ASGLAASGKR VVAASFACFL LCNAFDQIRM GVAYPRLNVK LVGSHAGISI       120
     GEDGPSQMGI EDVALALSLP GVAVLVPADE HATRAATRAM LEWEGPTYLR LGRPPVPVIY       180
     EPPVDFVIGR AFRLREGNDV TIIANGLMVA MALDAAEELA ARGVQARVLD MATVRPLDVD       240
     AVIAAARETR GIVVAEEHLH YGGLGSVVAM AVSQHHPCPM RFVDLDDRYA ESGAPDDLLR       300
     AYGLTSERIV AAALELTERI                                                   320
//

If you have problems or comments...

PBIL Back to PBIL home page