(data stored in ACNUC30630 zone)

EMBL: CP001275.PE476

CP001275.PE476       Location/Qualifiers
FT   CDS             483080..484351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0487"
FT                   /product="carboxyl-terminal processing protease"
FT                   /note="identified by match to protein family HMM PF00595;
FT                   match to protein family HMM PF03572; match to protein
FT                   family HMM TIGR00225"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04592"
FT                   /db_xref="GOA:B9KYE2"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004447"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR041489"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYE2"
FT                   /protein_id="ACM04592.1"
FT                   /translation="MRAETRPKRNSGSSRGPWVLLSLALFLAGFAIGQEWPRPLATPTP
FT                   AIMPTAAVMPTPVAVFSEAWSLLHEHYVDPAALDDQRLLAGALRGLADAVGDNGHTRYL
FT                   TAEELAQHSEQLSGEYSGVGIEISEQDNTIVVRDVFAGSPAARAGIQPGDVLVAVDGIP
FT                   VSELGLDGVVQRVRGPEGTVVTLVIQQVGKASPLEVRLVRSKVRFSGVRWAVLAERVGL
FT                   LRVSSFAAGTAEDARQGLSELAAAGARGVILDLRGNPGGLVDQAVDVAGLFLPPDTVVL
FT                   RSRDRSGKETVYRTKPDAQPVTLPLVVLVNRETASAAEIVAGALQDHRRAVIIGERTFG
FT                   TGTVLAEFRLRDGSALLIGTQVWVTPNGRVIWRNGIEPDITVAPAAEDVTIVPRRGEIL
FT                   PAEQIRSDSQLLAAWEYLLERDRA"
     MRAETRPKRN SGSSRGPWVL LSLALFLAGF AIGQEWPRPL ATPTPAIMPT AAVMPTPVAV        60
     FSEAWSLLHE HYVDPAALDD QRLLAGALRG LADAVGDNGH TRYLTAEELA QHSEQLSGEY       120
     SGVGIEISEQ DNTIVVRDVF AGSPAARAGI QPGDVLVAVD GIPVSELGLD GVVQRVRGPE       180
     GTVVTLVIQQ VGKASPLEVR LVRSKVRFSG VRWAVLAERV GLLRVSSFAA GTAEDARQGL       240
     SELAAAGARG VILDLRGNPG GLVDQAVDVA GLFLPPDTVV LRSRDRSGKE TVYRTKPDAQ       300
     PVTLPLVVLV NRETASAAEI VAGALQDHRR AVIIGERTFG TGTVLAEFRL RDGSALLIGT       360
     QVWVTPNGRV IWRNGIEPDI TVAPAAEDVT IVPRRGEILP AEQIRSDSQL LAAWEYLLER       420
     DRA                                                                     423
//

If you have problems or comments...

PBIL Back to PBIL home page