(data stored in ACNUC30630 zone)

EMBL: CP001275.PE477

CP001275.PE477       Location/Qualifiers
FT   CDS             484378..484782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0488"
FT                   /product="hypothetical conserved protein"
FT                   /note="similar to BH1559 unknown conserved protein in B.
FT                   subtilis; identified by match to protein family HMM
FT                   PF03745"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05462"
FT                   /db_xref="InterPro:IPR005500"
FT                   /db_xref="InterPro:IPR023203"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYE3"
FT                   /protein_id="ACM05462.1"
FT                   /translation="MREPDVSGNRASPPDAWRVASELYQAGDLFGCHEILEHVWRATEG
FT                   SLREFYRGLIQVVVGLYHAQRGNRVGARAVLARGLARIEQYPEDCLGMDWGPFRRSARC
FT                   YLEWLESGMEGAEPARPVWPRERYLDPTVQ"
     MREPDVSGNR ASPPDAWRVA SELYQAGDLF GCHEILEHVW RATEGSLREF YRGLIQVVVG        60
     LYHAQRGNRV GARAVLARGL ARIEQYPEDC LGMDWGPFRR SARCYLEWLE SGMEGAEPAR       120
     PVWPRERYLD PTVQ                                                         134
//

If you have problems or comments...

PBIL Back to PBIL home page