(data stored in ACNUC30630 zone)

EMBL: CP001275.PE486

CP001275.PE486       Location/Qualifiers
FT   CDS             494099..494998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0497"
FT                   /product="RuBisCO operon transcriptional regulator"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05752"
FT                   /db_xref="GOA:B9KYF2"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYF2"
FT                   /protein_id="ACM05752.1"
FT                   /translation="MDVSLRQLQVFRSVARHRSFSRAAEDLVISQPAVSAQIKSLEQVL
FT                   GVPLFQRTGRGVELTEAGRQLLPYAERLLNLLDEALAAVHELRCAQRGQVRVAASTTAG
FT                   IYVVPKALGAFHRAYPGVELSLDVLNRFAVHQRLLAGDADVAIMGLIEDPQDLEIEQFL
FT                   PNELVVIASPRHHLARRHQIPLDEIAREPFLVREIGSGTRADMERIFAEAGLSPRVAME
FT                   LRSNGAIKQAVAADLGVAVMPRDAIGLELETGRLIVLDVQGFPVRRWWSLVRRAGRQPS
FT                   AAADALWNFLLQYRLQAR"
     MDVSLRQLQV FRSVARHRSF SRAAEDLVIS QPAVSAQIKS LEQVLGVPLF QRTGRGVELT        60
     EAGRQLLPYA ERLLNLLDEA LAAVHELRCA QRGQVRVAAS TTAGIYVVPK ALGAFHRAYP       120
     GVELSLDVLN RFAVHQRLLA GDADVAIMGL IEDPQDLEIE QFLPNELVVI ASPRHHLARR       180
     HQIPLDEIAR EPFLVREIGS GTRADMERIF AEAGLSPRVA MELRSNGAIK QAVAADLGVA       240
     VMPRDAIGLE LETGRLIVLD VQGFPVRRWW SLVRRAGRQP SAAADALWNF LLQYRLQAR        299
//

If you have problems or comments...

PBIL Back to PBIL home page