(data stored in ACNUC30630 zone)

EMBL: CP001275.PE498

CP001275.PE498       Location/Qualifiers
FT   CDS             complement(508437..510500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0509"
FT                   /product="Protein of unknown function, DUF255 family"
FT                   /note="identified by match to protein family HMM PF03190"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ACM06021"
FT                   /db_xref="GOA:B9KYG4"
FT                   /db_xref="InterPro:IPR004879"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR024705"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYG4"
FT                   /protein_id="ACM06021.1"
FT                   /translation="MPNRLANEKSLYLRQHADNPVDWYPWCEEAFRVAREQDKPILLSI
FT                   GYSSCHWCHVMERECFENPEIAQLQNELFVNIKVDREERPDLDELYMNALQAMTGSGGW
FT                   PLNVFLTPDGKPFYGGTYFPPEDRGQLPAWPRVLLAVAQAYRERRADVERAAEDLVSYL
FT                   QQQSRPPLQAAPLREQFLDEAARNLVPHYDREHGGFGTAPKFPSPLQLEFLLRTFRRAG
FT                   APRALEMVLQTLTAMARGGIHDQIGGGFHRYTVDEAWLVPHFEKMLYDNALLARVYTLA
FT                   HLASGNRLCRTIAEETLVYIQREMRGDHGAFFAAQDADSEEGEGAFYLWTPEEIAAVLG
FT                   NDDAGLACRYFGVTPRGNFEGKSILHVAEDPVTIASEFGLSLDELEQRIGSIRARLYEA
FT                   RDQRPHPARDEKVIVAWNALAIRAFAEAGTALDRPDFVALAERAATFLRDQLWDGKTLY
FT                   HVWEEGEARFPGFLDDYADLVNALVSLYEATFDPFWIAWARQLTEAILAKFIDPVAGDF
FT                   YDTASDGEQLIVRPKTFIDQGTPSGNGATAEALLRLGTLLGEHRFIDQARTLLERYAQL
FT                   AVEHPIACGQLLLAMDFALGQPFEVAIIGDPTQPETRALLRVVQASYLPNRVLALRRPE
FT                   DEIAASIVPLLAERSLVDGHPAAYVCRNFACQRPVTTPQELASQLGIALPDS"
     MPNRLANEKS LYLRQHADNP VDWYPWCEEA FRVAREQDKP ILLSIGYSSC HWCHVMEREC        60
     FENPEIAQLQ NELFVNIKVD REERPDLDEL YMNALQAMTG SGGWPLNVFL TPDGKPFYGG       120
     TYFPPEDRGQ LPAWPRVLLA VAQAYRERRA DVERAAEDLV SYLQQQSRPP LQAAPLREQF       180
     LDEAARNLVP HYDREHGGFG TAPKFPSPLQ LEFLLRTFRR AGAPRALEMV LQTLTAMARG       240
     GIHDQIGGGF HRYTVDEAWL VPHFEKMLYD NALLARVYTL AHLASGNRLC RTIAEETLVY       300
     IQREMRGDHG AFFAAQDADS EEGEGAFYLW TPEEIAAVLG NDDAGLACRY FGVTPRGNFE       360
     GKSILHVAED PVTIASEFGL SLDELEQRIG SIRARLYEAR DQRPHPARDE KVIVAWNALA       420
     IRAFAEAGTA LDRPDFVALA ERAATFLRDQ LWDGKTLYHV WEEGEARFPG FLDDYADLVN       480
     ALVSLYEATF DPFWIAWARQ LTEAILAKFI DPVAGDFYDT ASDGEQLIVR PKTFIDQGTP       540
     SGNGATAEAL LRLGTLLGEH RFIDQARTLL ERYAQLAVEH PIACGQLLLA MDFALGQPFE       600
     VAIIGDPTQP ETRALLRVVQ ASYLPNRVLA LRRPEDEIAA SIVPLLAERS LVDGHPAAYV       660
     CRNFACQRPV TTPQELASQL GIALPDS                                           687
//

If you have problems or comments...

PBIL Back to PBIL home page