(data stored in ACNUC30630 zone)

EMBL: CP001275.PE504

CP001275.PE504       Location/Qualifiers
FT   CDS             513967..514854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0517"
FT                   /product="3-mercaptopyruvate sulfurtransferase"
FT                   /EC_number="2.8.1.2"
FT                   /note="identified by match to protein family HMM PF00581"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05678"
FT                   /db_xref="GOA:B9KYH0"
FT                   /db_xref="InterPro:IPR001307"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYH0"
FT                   /protein_id="ACM05678.1"
FT                   /translation="MVSERLTAHFVDTGWLAERLGNPLVRIVDCRYYFDGRDGYEEYRK
FT                   GHIPGARYLDWTVVTVDPHDPVAYRLAPSQYIAGRLGELGIGDEHLIVGYDDEGGHFVA
FT                   RLWLALAYYGKADRLRILEGGWTRWVAEGRSTATDEPVWPRAAFHLPSTPVHPELVADA
FT                   RDVLEALAFGKSVVLDVRRLSEYTGEEVRARHGGHVPGARHWFWQRSLDWDGLRMFRPP
FT                   EEVRAGLAELGVTTSTPVITYCHGGVRAAHAALALARAGFRHVRVYVGSWAEWGNRDDL
FT                   PRALGLPHGDGRES"
     MVSERLTAHF VDTGWLAERL GNPLVRIVDC RYYFDGRDGY EEYRKGHIPG ARYLDWTVVT        60
     VDPHDPVAYR LAPSQYIAGR LGELGIGDEH LIVGYDDEGG HFVARLWLAL AYYGKADRLR       120
     ILEGGWTRWV AEGRSTATDE PVWPRAAFHL PSTPVHPELV ADARDVLEAL AFGKSVVLDV       180
     RRLSEYTGEE VRARHGGHVP GARHWFWQRS LDWDGLRMFR PPEEVRAGLA ELGVTTSTPV       240
     ITYCHGGVRA AHAALALARA GFRHVRVYVG SWAEWGNRDD LPRALGLPHG DGRES            295
//

If you have problems or comments...

PBIL Back to PBIL home page