(data stored in ACNUC30630 zone)

EMBL: CP001275.PE507

CP001275.PE507       Location/Qualifiers
FT   CDS             516100..516717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0519"
FT                   /product="uncharacterized domain HDIG protein"
FT                   /note="identified by match to protein family HMM PF01966;
FT                   match to protein family HMM TIGR00277"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05971"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYH3"
FT                   /protein_id="ACM05971.1"
FT                   /translation="MERSLPTREEAWQLVREFTSQPHLLRHMRAVEAAMRAYARRFGEN
FT                   EELWGLVGILHDFDYERYPDISTEGHPVVGARILRERGYPEEVIRAILAHASEVTGVEP
FT                   ESLLEKTLVAVDELTGFLVAVALVRPTKSILDVEVSSVKKKWKAKEFAAAVNRQEIERA
FT                   AAALGVPLEEHIRIVLDAMKEIAHELGLERRPVEAARPALEG"
     MERSLPTREE AWQLVREFTS QPHLLRHMRA VEAAMRAYAR RFGENEELWG LVGILHDFDY        60
     ERYPDISTEG HPVVGARILR ERGYPEEVIR AILAHASEVT GVEPESLLEK TLVAVDELTG       120
     FLVAVALVRP TKSILDVEVS SVKKKWKAKE FAAAVNRQEI ERAAAALGVP LEEHIRIVLD       180
     AMKEIAHELG LERRPVEAAR PALEG                                             205
//

If you have problems or comments...

PBIL Back to PBIL home page