(data stored in ACNUC30630 zone)

EMBL: CP001275.PE517

CP001275.PE517       Location/Qualifiers
FT   CDS             527406..528380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0529"
FT                   /product="putative agmatinase"
FT                   /EC_number="3.5.3.11"
FT                   /note="identified by match to protein family HMM PF00491;
FT                   match to protein family HMM TIGR01230"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ACM06157"
FT                   /db_xref="GOA:B9KYI3"
FT                   /db_xref="InterPro:IPR005925"
FT                   /db_xref="InterPro:IPR006035"
FT                   /db_xref="InterPro:IPR020855"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYI3"
FT                   /protein_id="ACM06157.1"
FT                   /translation="MDEREDQGRVRWRPRFSGLRTFARFPHRAELAGVDVAIVGIPFDT
FT                   GVTYRPGARFGPAAVREHSSRIEQYHPPLDVDVTEYLTVIDYGDTPVVPMETLESYQLI
FT                   EETIRTVVEGGVIPVGIGGDHSVTLPELRAVARRFGPLALVHFDAHVDTWDTIWGTRYN
FT                   HGTPFRRAVEEGVVDPVRSIQIGIRGSLGERGELEQSRELGFAVWTAWEVRRAGIERVL
FT                   EAVRQRVGQHPVFVSFDIDFLDPAFAPGTGTPEVGGFAMWEAQELVWGLVGLNIVAADV
FT                   VEVLPDRDPAGVTALNAANIVFDLLAVLAATRRERHGTAERAE"
     MDEREDQGRV RWRPRFSGLR TFARFPHRAE LAGVDVAIVG IPFDTGVTYR PGARFGPAAV        60
     REHSSRIEQY HPPLDVDVTE YLTVIDYGDT PVVPMETLES YQLIEETIRT VVEGGVIPVG       120
     IGGDHSVTLP ELRAVARRFG PLALVHFDAH VDTWDTIWGT RYNHGTPFRR AVEEGVVDPV       180
     RSIQIGIRGS LGERGELEQS RELGFAVWTA WEVRRAGIER VLEAVRQRVG QHPVFVSFDI       240
     DFLDPAFAPG TGTPEVGGFA MWEAQELVWG LVGLNIVAAD VVEVLPDRDP AGVTALNAAN       300
     IVFDLLAVLA ATRRERHGTA ERAE                                              324
//

If you have problems or comments...

PBIL Back to PBIL home page