(data stored in ACNUC30630 zone)

EMBL: CP001275.PE526

CP001275.PE526       Location/Qualifiers
FT   CDS             532938..533237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0538"
FT                   /product="hypothetical protein"
FT                   /note="an automated process has identified a potential
FT                   problem with this gene model; the current end5 and/or the
FT                   end3 may need to extended or the current gene model may
FT                   need to be merged with a neighboring gene model; the
FT                   current gene model (or a revised gene model) may contain a
FT                   frame shift; identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05332"
FT                   /db_xref="GOA:B9KYJ2"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYJ2"
FT                   /protein_id="ACM05332.1"
FT                   /translation="MRQTWLLPVATATFVLFVAGSIAAVTMWSVAPWIIPLLAVPSLIV
FT                   TWFALAVALADLMRRPAHRFPGGRWLWLLLIALLNVVAFLPYWLLVARRPNEED"
     MRQTWLLPVA TATFVLFVAG SIAAVTMWSV APWIIPLLAV PSLIVTWFAL AVALADLMRR        60
     PAHRFPGGRW LWLLLIALLN VVAFLPYWLL VARRPNEED                               99
//

If you have problems or comments...

PBIL Back to PBIL home page