(data stored in ACNUC30630 zone)

EMBL: CP001275.PE529

CP001275.PE529       Location/Qualifiers
FT   CDS             535094..535222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0541"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05828"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYJ5"
FT                   /protein_id="ACM05828.1"
FT                   /translation="MEEFASERDWKAFLVWDMVELGKESSPPALARGAGDEPVHTP"
     MEEFASERDW KAFLVWDMVE LGKESSPPAL ARGAGDEPVH TP                           42
//

If you have problems or comments...

PBIL Back to PBIL home page