(data stored in ACNUC30630 zone)

EMBL: CP001275.PE539

CP001275.PE539       Location/Qualifiers
FT   CDS             complement(545370..545741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0551"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05067"
FT                   /db_xref="GOA:B9KYK5"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYK5"
FT                   /protein_id="ACM05067.1"
FT                   /translation="MMTVAVSPTLPYAIKYRKHGRIVCLGKICRNDDGELIFGVPYKGR
FT                   PFRTPSLPLPVYLHLLAAGVRWWIIRFDDQRKAYRIELARVDRVATIGTDGELTVPLRM
FT                   FEACPYPEWPYAVRSVLIR"
     MMTVAVSPTL PYAIKYRKHG RIVCLGKICR NDDGELIFGV PYKGRPFRTP SLPLPVYLHL        60
     LAAGVRWWII RFDDQRKAYR IELARVDRVA TIGTDGELTV PLRMFEACPY PEWPYAVRSV       120
     LIR                                                                     123
//

If you have problems or comments...

PBIL Back to PBIL home page