(data stored in ACNUC30630 zone)

EMBL: CP001275.PE542

CP001275.PE542       Location/Qualifiers
FT   CDS             complement(547416..548336)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0554"
FT                   /product="ABC-type multidrug transport system, ATPase
FT                   component"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM TIGR01188"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05595"
FT                   /db_xref="GOA:B9KYK8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005894"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR025302"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYK8"
FT                   /protein_id="ACM05595.1"
FT                   /translation="MTAAIEVHELVKQYGDVTAVAGINFTVARGEFFAFLGPNGAGKTT
FT                   TINILCTLARPTSGRARVASCDVVREPHRVRERIGIIFQDPSLDTQLTAWKNLALHARV
FT                   YGVPGTLWRQRAEQLLRLVELWDRRHQLVRTFSGGMKRRLELVRGLLHRPEILFLDEPT
FT                   LGLDPQTRRQIWSYLETLRRETGVTLFLTTHYLEEAEQCDRVAIIDHGRVIALDTPDRL
FT                   KARVGRDIIVLATADDARAASELRERFSLQPLVVDGTLRVEVERGDTFIPELVRQLSVP
FT                   IRSVSLRRPSLDDVFLALTGRQIRS"
     MTAAIEVHEL VKQYGDVTAV AGINFTVARG EFFAFLGPNG AGKTTTINIL CTLARPTSGR        60
     ARVASCDVVR EPHRVRERIG IIFQDPSLDT QLTAWKNLAL HARVYGVPGT LWRQRAEQLL       120
     RLVELWDRRH QLVRTFSGGM KRRLELVRGL LHRPEILFLD EPTLGLDPQT RRQIWSYLET       180
     LRRETGVTLF LTTHYLEEAE QCDRVAIIDH GRVIALDTPD RLKARVGRDI IVLATADDAR       240
     AASELRERFS LQPLVVDGTL RVEVERGDTF IPELVRQLSV PIRSVSLRRP SLDDVFLALT       300
     GRQIRS                                                                  306
//

If you have problems or comments...

PBIL Back to PBIL home page