(data stored in ACNUC30630 zone)

EMBL: CP001275.PE553

CP001275.PE553       Location/Qualifiers
FT   CDS             562388..563326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0565"
FT                   /product="Zn-dependent hydrolase"
FT                   /note="identified by match to protein family HMM PF00753"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04659"
FT                   /db_xref="GOA:B9KYL9"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR037482"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYL9"
FT                   /protein_id="ACM04659.1"
FT                   /translation="MRELEPGWYLVDLRFQGVENVIASYLFVGRQGVAIVDTGPSTTIE
FT                   RLVAALQELDVPPEAVRHLVLTHIHLDHGGAAGHLLERFPNARVYVHPLGAPHLIDPTR
FT                   LWASAARIYGDRMELLWGSIRPCAAERVVVVEDGEAIDLGDGRRLRALATPGHASHHHA
FT                   WLDTATGSVFAGDIAGIRISALPFVFPPTPPPDIDLGQWRRSIERLRRLQPSRLYLGHF
FT                   GPVEDIDWHLDDLLARLFLWAGWIGALLEQGLDAETIAGRLQELTDGEFHRLLGERAPV
FT                   IAYQWASGSFRMTVDGYVRYFRTHRPWASGS"
     MRELEPGWYL VDLRFQGVEN VIASYLFVGR QGVAIVDTGP STTIERLVAA LQELDVPPEA        60
     VRHLVLTHIH LDHGGAAGHL LERFPNARVY VHPLGAPHLI DPTRLWASAA RIYGDRMELL       120
     WGSIRPCAAE RVVVVEDGEA IDLGDGRRLR ALATPGHASH HHAWLDTATG SVFAGDIAGI       180
     RISALPFVFP PTPPPDIDLG QWRRSIERLR RLQPSRLYLG HFGPVEDIDW HLDDLLARLF       240
     LWAGWIGALL EQGLDAETIA GRLQELTDGE FHRLLGERAP VIAYQWASGS FRMTVDGYVR       300
     YFRTHRPWAS GS                                                           312
//

If you have problems or comments...

PBIL Back to PBIL home page