(data stored in ACNUC30630 zone)

EMBL: CP001275.PE560

CP001275.PE560       Location/Qualifiers
FT   CDS             complement(570358..571818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0572"
FT                   /product="Protein of unknown function (DUF1116)
FT                   superfamily"
FT                   /note="identified by match to protein family HMM PF06545"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04999"
FT                   /db_xref="InterPro:IPR009499"
FT                   /db_xref="InterPro:IPR024033"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYM6"
FT                   /protein_id="ACM04999.1"
FT                   /translation="MDGMHEKVQKLLETTPAVINVGLDLFARSVQDQGGAVYPVEWKPP
FT                   MVEPRRLALPLFNDPTIDAANREAVTRMMRAQPVVVGVARARDVIPGMTDRTFLHAGPP
FT                   IDWAHASGPLRGALIGAMLFEGFAATPEEAIRKLESGYVELSPNHEHSAVGPMAGVISP
FT                   SMPVYIAINAAGENRAYTNFNEGIGKVMRMGAYAPEVIDRLRWISTVLAPLVGQALARS
FT                   GGIDLRNIIAQALQMGDECHNRNKAATSLFYREIAPYLVECDAPLSDIAAVLRFINAND
FT                   HFFVNLAMVAAKVMADAAHGIPGSSLVTTLSRNGTEFGIRVSGLGDRWFTGPANVPRGL
FT                   YFPGFGPDDANPDIGDSAITETAGFGGFALAGAPAIVQFIGGTPADAVQATLEMYEITV
FT                   AEHEVFRIPALDFRGTPVGIDLRSVVRSGILPVIDTGIAHREPGIGQVGAGIVRPPARC
FT                   FTEAYRAFEDAYLAGHSRTTTLESRGMA"
     MDGMHEKVQK LLETTPAVIN VGLDLFARSV QDQGGAVYPV EWKPPMVEPR RLALPLFNDP        60
     TIDAANREAV TRMMRAQPVV VGVARARDVI PGMTDRTFLH AGPPIDWAHA SGPLRGALIG       120
     AMLFEGFAAT PEEAIRKLES GYVELSPNHE HSAVGPMAGV ISPSMPVYIA INAAGENRAY       180
     TNFNEGIGKV MRMGAYAPEV IDRLRWISTV LAPLVGQALA RSGGIDLRNI IAQALQMGDE       240
     CHNRNKAATS LFYREIAPYL VECDAPLSDI AAVLRFINAN DHFFVNLAMV AAKVMADAAH       300
     GIPGSSLVTT LSRNGTEFGI RVSGLGDRWF TGPANVPRGL YFPGFGPDDA NPDIGDSAIT       360
     ETAGFGGFAL AGAPAIVQFI GGTPADAVQA TLEMYEITVA EHEVFRIPAL DFRGTPVGID       420
     LRSVVRSGIL PVIDTGIAHR EPGIGQVGAG IVRPPARCFT EAYRAFEDAY LAGHSRTTTL       480
     ESRGMA                                                                  486
//

If you have problems or comments...

PBIL Back to PBIL home page