(data stored in ACNUC30630 zone)

EMBL: CP001275.PE565

CP001275.PE565       Location/Qualifiers
FT   CDS             575642..576136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0578"
FT                   /product="aldehyde oxidase small subunit"
FT                   /note="identified by match to protein family HMM PF00111;
FT                   match to protein family HMM PF01799"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04714"
FT                   /db_xref="GOA:B9KYN1"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036884"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYN1"
FT                   /protein_id="ACM04714.1"
FT                   /translation="MTAVGSERRVIRVTVNGVPYEREVEARLLLSDFLRHELGLTGTHV
FT                   GCEHGVCGACTILLDGEPVRSCLLLAVQAHGHELETVEGLAPSERELHPLQQAFWEKHG
FT                   LQCGYCTPGMLMVLKAFLAENPDPSEEEIREAISGNLCRCTGYQNIVEAARYAAQLMRQ
FT                   S"
     MTAVGSERRV IRVTVNGVPY EREVEARLLL SDFLRHELGL TGTHVGCEHG VCGACTILLD        60
     GEPVRSCLLL AVQAHGHELE TVEGLAPSER ELHPLQQAFW EKHGLQCGYC TPGMLMVLKA       120
     FLAENPDPSE EEIREAISGN LCRCTGYQNI VEAARYAAQL MRQS                        164
//

If you have problems or comments...

PBIL Back to PBIL home page