(data stored in ACNUC30630 zone)

EMBL: CP001275.PE582

CP001275.PE582       Location/Qualifiers
FT   CDS             complement(591464..592222)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0598"
FT                   /product="ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04865"
FT                   /db_xref="GOA:B9KYP8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYP8"
FT                   /protein_id="ACM04865.1"
FT                   /translation="MMRDRVLPSLLLITALFAWELACRVFAVPDWVLPPPSAILAALLR
FT                   DYRLLLFHLSVTMQEIGLGLIVSIVLAIVLAIGIVASRLIERSVYPLVVASQAIPIVAL
FT                   APLLLIWFGYGLTPKVIVVVLICFFPIAVNMVDGLRGVDHELIDMVRSLGASKWQTLRF
FT                   VRLPAALPAFFSGLRVAAAVSVIGALIGEWIGASAGLGYLMIRAAAQFHTDRVFAAVLV
FT                   SALVSIALFASVTWLERQTLPWRTRPRTEP"
     MMRDRVLPSL LLITALFAWE LACRVFAVPD WVLPPPSAIL AALLRDYRLL LFHLSVTMQE        60
     IGLGLIVSIV LAIVLAIGIV ASRLIERSVY PLVVASQAIP IVALAPLLLI WFGYGLTPKV       120
     IVVVLICFFP IAVNMVDGLR GVDHELIDMV RSLGASKWQT LRFVRLPAAL PAFFSGLRVA       180
     AAVSVIGALI GEWIGASAGL GYLMIRAAAQ FHTDRVFAAV LVSALVSIAL FASVTWLERQ       240
     TLPWRTRPRT EP                                                           252
//

If you have problems or comments...

PBIL Back to PBIL home page