(data stored in ACNUC30630 zone)

EMBL: CP001275.PE586

CP001275.PE586       Location/Qualifiers
FT   CDS             complement(594628..595017)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0602"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04620"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYQ2"
FT                   /protein_id="ACM04620.1"
FT                   /translation="MMSLAACRRGGQAGVTTVTVELGEYYIKVDKAEVPAGKVRFVAKN
FT                   VGQMEHELIVLRTDLPADRLPYNEAEQKAEEEQAGEVLGEIEPEDLPPGKTAEMTLDLT
FT                   AGHYVLLCNIPTHYKQGMHLDLRAR"
     MMSLAACRRG GQAGVTTVTV ELGEYYIKVD KAEVPAGKVR FVAKNVGQME HELIVLRTDL        60
     PADRLPYNEA EQKAEEEQAG EVLGEIEPED LPPGKTAEMT LDLTAGHYVL LCNIPTHYKQ       120
     GMHLDLRAR                                                               129
//

If you have problems or comments...

PBIL Back to PBIL home page