(data stored in ACNUC30630 zone)

EMBL: CP001275.PE587

CP001275.PE587       Location/Qualifiers
FT   CDS             complement(595403..596314)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0603"
FT                   /product="ribonuclease Z"
FT                   /EC_number="3.1.26.11"
FT                   /note="identified by match to protein family HMM PF00753"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05790"
FT                   /db_xref="GOA:B9KYQ3"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR013471"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9KYQ3"
FT                   /protein_id="ACM05790.1"
FT                   /translation="MVDVCLLGTGGMMPLPDRWLSALLVRCEGHVVLLDCGEGTQISWR
FT                   YTGWSFRDLDAIVFTHLHADHVAGLPGILYALAFADRQEPVRIIGPVGTAQVVAALRSI
FT                   VPTLPFPVETLELSGTSELELPGGLLLRALPVTHRIPCFAYTLHRPRGRRFDPQRAQAL
FT                   GIPMTLWHRLQRGETVEFAGQLLTPDLVLGPPRRGITVAFVTDTRPTPELPGFVAGADL
FT                   LVCEGMYGDTALLPRAIERGHMLMQEAAELARAASVERLWLTHFSPSLTDPEAWLPAIR
FT                   AIFPASEIGPVHQTVTLRYRDA"
     MVDVCLLGTG GMMPLPDRWL SALLVRCEGH VVLLDCGEGT QISWRYTGWS FRDLDAIVFT        60
     HLHADHVAGL PGILYALAFA DRQEPVRIIG PVGTAQVVAA LRSIVPTLPF PVETLELSGT       120
     SELELPGGLL LRALPVTHRI PCFAYTLHRP RGRRFDPQRA QALGIPMTLW HRLQRGETVE       180
     FAGQLLTPDL VLGPPRRGIT VAFVTDTRPT PELPGFVAGA DLLVCEGMYG DTALLPRAIE       240
     RGHMLMQEAA ELARAASVER LWLTHFSPSL TDPEAWLPAI RAIFPASEIG PVHQTVTLRY       300
     RDA                                                                     303
//

If you have problems or comments...

PBIL Back to PBIL home page