(data stored in ACNUC30630 zone)

EMBL: CP001275.PE592

CP001275.PE592       Location/Qualifiers
FT   CDS             complement(601154..602281)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0608"
FT                   /product="6-phosphofructokinase 1"
FT                   /EC_number="2.7.1.11"
FT                   /note="identified by match to protein family HMM PF00365"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05352"
FT                   /db_xref="GOA:B9KYQ8"
FT                   /db_xref="InterPro:IPR000023"
FT                   /db_xref="InterPro:IPR012003"
FT                   /db_xref="InterPro:IPR012829"
FT                   /db_xref="InterPro:IPR015912"
FT                   /db_xref="InterPro:IPR022953"
FT                   /db_xref="InterPro:IPR035966"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYQ8"
FT                   /protein_id="ACM05352.1"
FT                   /translation="MAERSLRRIGVLTGGGDAPGLNAALRAVVKTAILRYGWTVIGFED
FT                   GYEGAILGRARQLGLDDVRGLLVRGGTILGASNRANPFFFAHPEQGDTEPRDHSRTLLA
FT                   TLERIGIDALIVIGGEGSLSIAHRLNEMGLRVIGIPKTIDNDVRGTLQTIGFDTAVTTA
FT                   TEAIDRLHTTAESHHRVMLVELMGRDAGWIALSAGVAGGADVILIPEIPFVLDRVVEVI
FT                   RGRRQRRRSFTIVAVAEGARPLDGEAVFERTGPLPYQRKYGGISLVLQKQLSRILPTEV
FT                   RAVVLGHLQRGGTPTPTDRALATALGSAAVDALADDDDGVMVAIRAHPAGQATWGIVRV
FT                   PLAEVARGPRLVPLDHPLVRAARGIGISFAQQDEE"
     MAERSLRRIG VLTGGGDAPG LNAALRAVVK TAILRYGWTV IGFEDGYEGA ILGRARQLGL        60
     DDVRGLLVRG GTILGASNRA NPFFFAHPEQ GDTEPRDHSR TLLATLERIG IDALIVIGGE       120
     GSLSIAHRLN EMGLRVIGIP KTIDNDVRGT LQTIGFDTAV TTATEAIDRL HTTAESHHRV       180
     MLVELMGRDA GWIALSAGVA GGADVILIPE IPFVLDRVVE VIRGRRQRRR SFTIVAVAEG       240
     ARPLDGEAVF ERTGPLPYQR KYGGISLVLQ KQLSRILPTE VRAVVLGHLQ RGGTPTPTDR       300
     ALATALGSAA VDALADDDDG VMVAIRAHPA GQATWGIVRV PLAEVARGPR LVPLDHPLVR       360
     AARGIGISFA QQDEE                                                        375
//

If you have problems or comments...

PBIL Back to PBIL home page