(data stored in ACNUC30630 zone)

EMBL: CP001275.PE597

CP001275.PE597       Location/Qualifiers
FT   CDS             607365..607817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0616"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00498"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05863"
FT                   /db_xref="GOA:B9KYR3"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYR3"
FT                   /protein_id="ACM05863.1"
FT                   /translation="MELVTQLPFEWFVLLLRLVFAFLLYFFIFLLARIMLRELAAAAVT
FT                   SSEEGGPPGHLIVQSPGSTGLRPGTRLPLEPVTVIGRHPSCTVRLDDAFISTEHAQLTW
FT                   EQGRWWITDLKSTNGTRVNGKPVTAPTGLRYGDVIELGDVRLVLAP"
     MELVTQLPFE WFVLLLRLVF AFLLYFFIFL LARIMLRELA AAAVTSSEEG GPPGHLIVQS        60
     PGSTGLRPGT RLPLEPVTVI GRHPSCTVRL DDAFISTEHA QLTWEQGRWW ITDLKSTNGT       120
     RVNGKPVTAP TGLRYGDVIE LGDVRLVLAP                                        150
//

If you have problems or comments...

PBIL Back to PBIL home page