(data stored in ACNUC30630 zone)

EMBL: CP001275.PE613

CP001275.PE613       Location/Qualifiers
FT   CDS             complement(622342..622602)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0633"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0633"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04709"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYS9"
FT                   /protein_id="ACM04709.1"
FT                   /translation="MRPQPASEQWQCELIGELILRYYFLQPAPTQWVAVGLLGTETGTI
FT                   FRVGCGSEPETALVDLRERLLVALSELTERSVPSRLVNCAA"
     MRPQPASEQW QCELIGELIL RYYFLQPAPT QWVAVGLLGT ETGTIFRVGC GSEPETALVD        60
     LRERLLVALS ELTERSVPSR LVNCAA                                             86
//

If you have problems or comments...

PBIL Back to PBIL home page