(data stored in ACNUC30630 zone)

EMBL: CP001275.PE74

CP001275.PE74        Location/Qualifiers
FT   CDS             85026..85256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0076"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05258"
FT                   /db_xref="UniProtKB/TrEMBL:B9L294"
FT                   /protein_id="ACM05258.1"
FT                   /translation="MGISGGLVFRPPVHVVGARSISFVDRVHPCWLTVLSSREFDEGEP
FT                   NQRPTAYREALGKLLLSRSGPGAHAGAVIRG"
     MGISGGLVFR PPVHVVGARS ISFVDRVHPC WLTVLSSREF DEGEPNQRPT AYREALGKLL        60
     LSRSGPGAHA GAVIRG                                                        76
//

If you have problems or comments...

PBIL Back to PBIL home page