(data stored in ACNUC30630 zone)

EMBL: CP001275.PE75

CP001275.PE75        Location/Qualifiers
FT   CDS             85283..86776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0077"
FT                   /product="putative FAD dependent oxidoreductase"
FT                   /note="identified by match to protein family HMM PF01266"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04591"
FT                   /db_xref="GOA:B9L295"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B9L295"
FT                   /protein_id="ACM04591.1"
FT                   /translation="MVVRETLPVVVVGAGPIGLVAAAHLAQRGLPFLVLEAGPDIATSV
FT                   RRWSHVRMFSPWHFDLDPVAVSLLTSEGWSSPDPESYPTGGEFIARFLEPLARHPLIRP
FT                   ALRFSHRVTAIGRLGRDKLSGHDRAGRPFAVRVMTPTGEQELLARAVLDASGAIPNPLG
FT                   GSGWPAIGERACTDSIDYGMPDVLGRDRARYAGARTLVVGAGHSAFGTLLDLVSLAEQE
FT                   PGTVVHWAIRRRSLAGRLGSPQDELPERGRLGQRLAAALEADRIVLHRGILVDRLERTS
FT                   QGIVVFAGERALPPVDRIVCATGYRPDLGLLRELRLALDTVVEAPVALAPAIDPALHSC
FT                   GTVPPHGVEELTHPQEPDFFVVGLKSYGRAPTFLLRTGYEQVRSIVAALAGDWEAARRV
FT                   ELRLPATGVCGGEKGEACCSEPGVTEKETDQPTAVAKRPLLLVGGPERARLRPALEISG
FT                   PACPWPRPSKAEQGVCCADRADEPVCTCESESAGQTCGG"
     MVVRETLPVV VVGAGPIGLV AAAHLAQRGL PFLVLEAGPD IATSVRRWSH VRMFSPWHFD        60
     LDPVAVSLLT SEGWSSPDPE SYPTGGEFIA RFLEPLARHP LIRPALRFSH RVTAIGRLGR       120
     DKLSGHDRAG RPFAVRVMTP TGEQELLARA VLDASGAIPN PLGGSGWPAI GERACTDSID       180
     YGMPDVLGRD RARYAGARTL VVGAGHSAFG TLLDLVSLAE QEPGTVVHWA IRRRSLAGRL       240
     GSPQDELPER GRLGQRLAAA LEADRIVLHR GILVDRLERT SQGIVVFAGE RALPPVDRIV       300
     CATGYRPDLG LLRELRLALD TVVEAPVALA PAIDPALHSC GTVPPHGVEE LTHPQEPDFF       360
     VVGLKSYGRA PTFLLRTGYE QVRSIVAALA GDWEAARRVE LRLPATGVCG GEKGEACCSE       420
     PGVTEKETDQ PTAVAKRPLL LVGGPERARL RPALEISGPA CPWPRPSKAE QGVCCADRAD       480
     EPVCTCESES AGQTCGG                                                      497
//

If you have problems or comments...

PBIL Back to PBIL home page