(data stored in ACNUC30630 zone)

EMBL: CP001275.PE96

CP001275.PE96        Location/Qualifiers
FT   CDS             106513..107001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0098"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04952"
FT                   /db_xref="UniProtKB/TrEMBL:B9L2B6"
FT                   /protein_id="ACM04952.1"
FT                   /translation="MASVDELRGYPVAEPAPDLYQLLERLQELAERSRRMPFSNSLMID
FT                   EHELLDLVYSLRQAFPRELRQARRVLQDRQQIIAEAQLEAQRILATAQERAQYLMSEQG
FT                   IMNETRARCEEMLRQAMERKQRIMSETDEYVRQMLEQIEAAALSTLQHVQRVKTELKL"
     MASVDELRGY PVAEPAPDLY QLLERLQELA ERSRRMPFSN SLMIDEHELL DLVYSLRQAF        60
     PRELRQARRV LQDRQQIIAE AQLEAQRILA TAQERAQYLM SEQGIMNETR ARCEEMLRQA       120
     MERKQRIMSE TDEYVRQMLE QIEAAALSTL QHVQRVKTEL KL                          162
//

If you have problems or comments...

PBIL Back to PBIL home page