(data stored in ACNUC30630 zone)

EMBL: CP001275.PROS

CP001275.PROS        Location/Qualifiers
FT   CDS             602437..603891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proS"
FT                   /locus_tag="trd_0609"
FT                   /product="prolyl-tRNA synthetase"
FT                   /EC_number="6.1.1.15"
FT                   /note="identified by match to protein family HMM PF00587;
FT                   match to protein family HMM PF03129; match to protein
FT                   family HMM PF09180; match to protein family HMM TIGR00408"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05220"
FT                   /db_xref="GOA:B9KYQ9"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002316"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004499"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR016061"
FT                   /db_xref="InterPro:IPR017449"
FT                   /db_xref="InterPro:IPR033721"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYQ9"
FT                   /protein_id="ACM05220.1"
FT                   /translation="MTTDRKYVEELIEQEDDFDRWYVEVIQKAELADESPVRGTRVIRP
FT                   YGFALWENMQAELDRRIKATGVQNAYFPLFIPKSFLEREAEHIKGFAPEVAWVTRGGDK
FT                   ELEEWLAVRPTSESIICPMFARWVQSYRDLPILINQWCSVVRWEERPRAFLRTLEFLWQ
FT                   EGHTVHATLEEAEERARLMLEVYRDFVESELAIPVIPGQKTESEKFAGALRTYTIEAMM
FT                   GGKHWALQSATSHNLGDHFGKVFDITFLDREGKRRYVFNTSWGLSHRTIGAMVMVHGDD
FT                   RGLKLPPRVAPIQVVIVPIWRKDEERRQVEETVDRVRAMLRRAVRVHADLRDDKTPGWK
FT                   FNDWDLKGVPIRLEIGPRDVASDQVTLVRRDVLGQRQAVPIANLVGAVQSELESIQVSL
FT                   FRAARAMLERYTEDVRDYEVLKERVATNAGFNRAFWCGDPACEARVKAETKATVRCIPF
FT                   EQPAELEPCLVCGAPGKYQVIWARAY"
     MTTDRKYVEE LIEQEDDFDR WYVEVIQKAE LADESPVRGT RVIRPYGFAL WENMQAELDR        60
     RIKATGVQNA YFPLFIPKSF LEREAEHIKG FAPEVAWVTR GGDKELEEWL AVRPTSESII       120
     CPMFARWVQS YRDLPILINQ WCSVVRWEER PRAFLRTLEF LWQEGHTVHA TLEEAEERAR       180
     LMLEVYRDFV ESELAIPVIP GQKTESEKFA GALRTYTIEA MMGGKHWALQ SATSHNLGDH       240
     FGKVFDITFL DREGKRRYVF NTSWGLSHRT IGAMVMVHGD DRGLKLPPRV APIQVVIVPI       300
     WRKDEERRQV EETVDRVRAM LRRAVRVHAD LRDDKTPGWK FNDWDLKGVP IRLEIGPRDV       360
     ASDQVTLVRR DVLGQRQAVP IANLVGAVQS ELESIQVSLF RAARAMLERY TEDVRDYEVL       420
     KERVATNAGF NRAFWCGDPA CEARVKAETK ATVRCIPFEQ PAELEPCLVC GAPGKYQVIW       480
     ARAY                                                                    484
//

If you have problems or comments...

PBIL Back to PBIL home page