(data stored in ACNUC30630 zone)

EMBL: CP001275.PURE

CP001275.PURE        Location/Qualifiers
FT   CDS             complement(638704..639219)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purE"
FT                   /locus_tag="trd_0646"
FT                   /product="phosphoribosylaminoimidazole carboxylase,
FT                   catalytic subunit"
FT                   /EC_number="4.1.1.21"
FT                   /note="identified by match to protein family HMM PF00731;
FT                   match to protein family HMM TIGR01162"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0646"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05547"
FT                   /db_xref="GOA:B9KYU2"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="InterPro:IPR024694"
FT                   /db_xref="InterPro:IPR033747"
FT                   /db_xref="InterPro:IPR035893"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYU2"
FT                   /protein_id="ACM05547.1"
FT                   /translation="MQVTNASSRPLVGIIMGSRSDWETMSHAASTLDHLNIPYEVRVVS
FT                   AHRTPDLMFEYAATAEARGIEVIIAGAGGAAHLPGMTAAKTVVPVLGVPVQTHTLHGLD
FT                   SLLSIVQMPAGVPVGTLAIGRAGAVNAALLAAAILGTKYPEIRERLRRFRDEQTRAVLE
FT                   NPDPRQAP"
     MQVTNASSRP LVGIIMGSRS DWETMSHAAS TLDHLNIPYE VRVVSAHRTP DLMFEYAATA        60
     EARGIEVIIA GAGGAAHLPG MTAAKTVVPV LGVPVQTHTL HGLDSLLSIV QMPAGVPVGT       120
     LAIGRAGAVN AALLAAAILG TKYPEIRERL RRFRDEQTRA VLENPDPRQA P                171
//

If you have problems or comments...

PBIL Back to PBIL home page