(data stored in ACNUC30630 zone)

EMBL: CP001275.RECO

CP001275.RECO        Location/Qualifiers
FT   CDS             complement(203034..203870)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recO"
FT                   /locus_tag="trd_0196"
FT                   /product="DNA repair protein RecO"
FT                   /note="identified by match to protein family HMM PF02565;
FT                   match to protein family HMM TIGR00613"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04992"
FT                   /db_xref="GOA:B9KXK9"
FT                   /db_xref="InterPro:IPR003717"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022572"
FT                   /db_xref="InterPro:IPR037278"
FT                   /db_xref="InterPro:IPR042242"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXK9"
FT                   /protein_id="ACM04992.1"
FT                   /translation="MIGERGMAETTNHRIRLYRTEAIVLRRRDLGEADRILTLFTPKAG
FT                   KLRVIAKGIRRPQSRLAGHLDLFVRTQVLLARGRELDIVTQAQLVEPFTGLRREPWRAG
FT                   WAGYLADLTDRATVDEDPQPALYDLLLECLRLLAELPDPFAVVRRFEMRLLVLLGYQPE
FT                   LVVCPHCGKQLTPGRLAFAPDHGGILCGECVGHSAGEVPLSVGAVKALRLLLADHWQEL
FT                   ARRPLSLALRGQITSALQAALQAHIGDIAASAAVATLLQEEGHDDGHPPSLAGTSS"
     MIGERGMAET TNHRIRLYRT EAIVLRRRDL GEADRILTLF TPKAGKLRVI AKGIRRPQSR        60
     LAGHLDLFVR TQVLLARGRE LDIVTQAQLV EPFTGLRREP WRAGWAGYLA DLTDRATVDE       120
     DPQPALYDLL LECLRLLAEL PDPFAVVRRF EMRLLVLLGY QPELVVCPHC GKQLTPGRLA       180
     FAPDHGGILC GECVGHSAGE VPLSVGAVKA LRLLLADHWQ ELARRPLSLA LRGQITSALQ       240
     AALQAHIGDI AASAAVATLL QEEGHDDGHP PSLAGTSS                               278
//

If you have problems or comments...

PBIL Back to PBIL home page