(data stored in ACNUC30630 zone)

EMBL: CP001275.RPSU

CP001275.RPSU        Location/Qualifiers
FT   CDS             532651..532875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsU"
FT                   /locus_tag="trd_0537"
FT                   /product="ribosomal protein S21"
FT                   /note="identified by match to protein family HMM PF01165;
FT                   match to protein family HMM TIGR00030"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04511"
FT                   /db_xref="GOA:B9KYJ1"
FT                   /db_xref="InterPro:IPR001911"
FT                   /db_xref="InterPro:IPR038380"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYJ1"
FT                   /protein_id="ACM04511.1"
FT                   /translation="MAKSVHVELRENESFDALLKRFTKELQKAGVLRDYRAKRHYVSKS
FT                   EQRRAKIRKAEHRRRRKLAKLAKKGQLGL"
     MAKSVHVELR ENESFDALLK RFTKELQKAG VLRDYRAKRH YVSKSEQRRA KIRKAEHRRR        60
     RKLAKLAKKG QLGL                                                          74
//

If you have problems or comments...

PBIL Back to PBIL home page