(data stored in ACNUC30630 zone)

EMBL: CP001275.TRPC

CP001275.TRPC        Location/Qualifiers
FT   CDS             113491..114318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpC"
FT                   /locus_tag="trd_0105"
FT                   /product="indole-3-glycerol phosphate synthase"
FT                   /EC_number="4.1.1.48"
FT                   /note="identified by match to protein family HMM PF00218"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ACM06153"
FT                   /db_xref="GOA:B9KXB9"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR013798"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXB9"
FT                   /protein_id="ACM06153.1"
FT                   /translation="MTRTGTVLDRIVERTSADLAERRRRVPEGALRAQAHEQAPPVPLV
FT                   PALRADRVSVIAEVKRGSPSRGLFAPEADAAAVAMDYLAGGAAALSVLTDEPFFHGSLK
FT                   DLAVVARLAHASPGPVPVLRKDFLLDPYQIVEARAHGADAVLLIVAVLDRWQLAELLGV
FT                   TWELGMEALVEVHDESELATAVEAGARVIGINNRDLRTFTVDLTVSERLAPLVPADRVV
FT                   VAESGIHSVADVERLARAGIDAILVGEALMMAPDRRAIVQALGSVEVVRCRGS"
     MTRTGTVLDR IVERTSADLA ERRRRVPEGA LRAQAHEQAP PVPLVPALRA DRVSVIAEVK        60
     RGSPSRGLFA PEADAAAVAM DYLAGGAAAL SVLTDEPFFH GSLKDLAVVA RLAHASPGPV       120
     PVLRKDFLLD PYQIVEARAH GADAVLLIVA VLDRWQLAEL LGVTWELGME ALVEVHDESE       180
     LATAVEAGAR VIGINNRDLR TFTVDLTVSE RLAPLVPADR VVVAESGIHS VADVERLARA       240
     GIDAILVGEA LMMAPDRRAI VQALGSVEVV RCRGS                                  275
//

If you have problems or comments...

PBIL Back to PBIL home page