(data stored in ACNUC30630 zone)

EMBL: CP001275.UREB

CP001275.UREB        Location/Qualifiers
FT   CDS             complement(530709..531098)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ureB"
FT                   /locus_tag="trd_0532"
FT                   /product="urease, beta subunit"
FT                   /note="an automated process has identified a potential
FT                   problem with this gene model; the current end5 and/or the
FT                   end3 may need to extended or the current gene model may
FT                   need to be merged with a neighboring gene model; the
FT                   current gene model (or a revised gene model) may contain a
FT                   frame shift; identified by match to protein family HMM
FT                   PF00699; match to protein family HMM TIGR00192"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05631"
FT                   /db_xref="GOA:B9KYI6"
FT                   /db_xref="InterPro:IPR002019"
FT                   /db_xref="InterPro:IPR036461"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYI6"
FT                   /protein_id="ACM05631.1"
FT                   /translation="MSEHPVPPGGIIPGPDPIEIDARLPVTRLRITNRGTVPIHLTAHF
FT                   HVFEANPALCFDRRKGFGMRPDLPVGWAVRIEPGQTVELPVVPIGGQRIVRGFHGLVDG
FT                   PLDAIDLEALIERMIARGFCHEPEE"
     MSEHPVPPGG IIPGPDPIEI DARLPVTRLR ITNRGTVPIH LTAHFHVFEA NPALCFDRRK        60
     GFGMRPDLPV GWAVRIEPGQ TVELPVVPIG GQRIVRGFHG LVDGPLDAID LEALIERMIA       120
     RGFCHEPEE                                                               129
//

If you have problems or comments...

PBIL Back to PBIL home page