(data stored in ACNUC30630 zone)

EMBL: CP001275.UVRC

CP001275.UVRC        Location/Qualifiers
FT   CDS             423042..424919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uvrC"
FT                   /locus_tag="trd_0427"
FT                   /product="excinuclease ABC, C subunit"
FT                   /note="identified by match to protein family HMM PF00633;
FT                   match to protein family HMM PF01541; match to protein
FT                   family HMM PF02151; match to protein family HMM PF08459;
FT                   match to protein family HMM TIGR00194"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05036"
FT                   /db_xref="GOA:B9KY82"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR001162"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR004791"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="InterPro:IPR038476"
FT                   /db_xref="UniProtKB/TrEMBL:B9KY82"
FT                   /protein_id="ACM05036.1"
FT                   /translation="MTLDMVRDMRKTSEQVIQERLAALEPAPGVYLMKDAQGRVIYVGK
FT                   ASSLRQRLRSYFSSHSSMDAKTRELVSQIADFEVIRTDTPTEALILENELIKRYRPRFN
FT                   IMLRDDKTYPFIRITNEPFPRVIATRRIVRDGSRYFGPYPSAGAVHRTLDLLKRLFPYR
FT                   ACDIEITGTASRACLYYHIGRCAGPCIGAVSQEEYRGIIDNVVLFLEGRAEAVVARLQA
FT                   AMEEAAERLEFERAARIRDELRAIQHVLQQQKIVTGTDESFDVLAVAQSAGGDACVQIG
FT                   FVRNGKLLGSEHYLMVGARIDDPPGAILTSFVQQYYAQASTVPPELVLQHPLDDGETIA
FT                   AWLAARRDGPVRLTVPDDGFRRELVEMIAKSAVQNLEQHRVRWLNDEQRTTLALEELAD
FT                   ALGMDRLPRRIECFDVSQLQGTNVVASMVVFEHGKPKKSDYRKFQIKTVEGQDDYAALR
FT                   EAVLRRYRRALSAEQTEAWQALPDLVLIDGGKGQLSAAREALVELGLDLPIAALAKEHE
FT                   ELYIPDQSEPIVLPRDSQALFLVQRVRDEAHRFAVTFHRARRTRSTIRSLLDEIPGIGP
FT                   RRRRELLRRFGSVEGIRQASIEEIAAVPGISRALAERIKKELDEARAPR"
     MTLDMVRDMR KTSEQVIQER LAALEPAPGV YLMKDAQGRV IYVGKASSLR QRLRSYFSSH        60
     SSMDAKTREL VSQIADFEVI RTDTPTEALI LENELIKRYR PRFNIMLRDD KTYPFIRITN       120
     EPFPRVIATR RIVRDGSRYF GPYPSAGAVH RTLDLLKRLF PYRACDIEIT GTASRACLYY       180
     HIGRCAGPCI GAVSQEEYRG IIDNVVLFLE GRAEAVVARL QAAMEEAAER LEFERAARIR       240
     DELRAIQHVL QQQKIVTGTD ESFDVLAVAQ SAGGDACVQI GFVRNGKLLG SEHYLMVGAR       300
     IDDPPGAILT SFVQQYYAQA STVPPELVLQ HPLDDGETIA AWLAARRDGP VRLTVPDDGF       360
     RRELVEMIAK SAVQNLEQHR VRWLNDEQRT TLALEELADA LGMDRLPRRI ECFDVSQLQG       420
     TNVVASMVVF EHGKPKKSDY RKFQIKTVEG QDDYAALREA VLRRYRRALS AEQTEAWQAL       480
     PDLVLIDGGK GQLSAAREAL VELGLDLPIA ALAKEHEELY IPDQSEPIVL PRDSQALFLV       540
     QRVRDEAHRF AVTFHRARRT RSTIRSLLDE IPGIGPRRRR ELLRRFGSVE GIRQASIEEI       600
     AAVPGISRAL AERIKKELDE ARAPR                                             625
//

If you have problems or comments...

PBIL Back to PBIL home page