(data stored in ACNUC7421 zone)

EMBL: CP001349.PE1

CP001349.PE1         Location/Qualifiers
FT   CDS             1..1500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="KEGG: met:M446_0001 chromosomal replication
FT                   initiator protein DnaA; TIGRFAM: chromosomal replication
FT                   initiator protein DnaA; PFAM: Chromosomal replication
FT                   initiator DnaA domain; Chromosomal replication initiator
FT                   DnaA; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55053"
FT                   /db_xref="GOA:B8ISZ1"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:B8ISZ1"
FT                   /inference="protein motif:TFAM:TIGR00362"
FT                   /protein_id="ACL55053.1"
FT                   /translation="MRVDGSLAEGFDPGGGGSSGSGGGGDVAAAWQRVKRRLRAELGED
FT                   VFASWFARLELQEVSGGTARLTVPTRFLKSWIESHYLDRVLATFRSEADGVEGIEVGVR
FT                   GPMAPARAAPVGMAPAAPKAATPVRLAASAPAAAETAEADRAGRSEAADLSGAPLDPRL
FT                   TFQSFVVGRSNALAHAAAERVAAHDGGGPVYNPLYFHAGVGLGKTHLLHAIGHAAKEVG
FT                   RRVIYLTADRFMYGFVNALKTQNALAFKERLRAIDVLILDDVQFIQGRSIQAEFGHTLN
FT                   ALIDAGRQVVAAADRPPTELESLDERVRSRLAGGLVVEIGTLDEALRATILQSRLEAVR
FT                   ATHPAFEVSPAVAEYVAKAITANGRDLEGAVNRLLAHATLTGAPVTLETAETAIRDLVK
FT                   NREPKRVKIEDIQKLVASRYNVSRSDILSERRTAAVVKPRQIAMYLSKVLTLRSLPEIG
FT                   RRFGGRDHTTVLHAVRKIEKAIGEDSALCDEVELLKRMLQD"
     MRVDGSLAEG FDPGGGGSSG SGGGGDVAAA WQRVKRRLRA ELGEDVFASW FARLELQEVS        60
     GGTARLTVPT RFLKSWIESH YLDRVLATFR SEADGVEGIE VGVRGPMAPA RAAPVGMAPA       120
     APKAATPVRL AASAPAAAET AEADRAGRSE AADLSGAPLD PRLTFQSFVV GRSNALAHAA       180
     AERVAAHDGG GPVYNPLYFH AGVGLGKTHL LHAIGHAAKE VGRRVIYLTA DRFMYGFVNA       240
     LKTQNALAFK ERLRAIDVLI LDDVQFIQGR SIQAEFGHTL NALIDAGRQV VAAADRPPTE       300
     LESLDERVRS RLAGGLVVEI GTLDEALRAT ILQSRLEAVR ATHPAFEVSP AVAEYVAKAI       360
     TANGRDLEGA VNRLLAHATL TGAPVTLETA ETAIRDLVKN REPKRVKIED IQKLVASRYN       420
     VSRSDILSER RTAAVVKPRQ IAMYLSKVLT LRSLPEIGRR FGGRDHTTVL HAVRKIEKAI       480
     GEDSALCDEV ELLKRMLQD                                                    499
//

If you have problems or comments...

PBIL Back to PBIL home page