(data stored in ACNUC7421 zone)

EMBL: CP001349.PE10

CP001349.PE10        Location/Qualifiers
FT   CDS             13151..13489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0011"
FT                   /product="glutaredoxin-like protein"
FT                   /note="TIGRFAM: glutaredoxin-like protein; PFAM:
FT                   glutaredoxin; KEGG: met:M446_0007 glutaredoxin-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55062"
FT                   /db_xref="GOA:B8IT00"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR004480"
FT                   /db_xref="InterPro:IPR014434"
FT                   /db_xref="InterPro:IPR033658"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B8IT00"
FT                   /inference="protein motif:TFAM:TIGR00365"
FT                   /protein_id="ACL55062.1"
FT                   /translation="MTDINTRIENEIKSQDVVVFMKGTPQFPMCGFSGQVAQILNYLGV
FT                   DYKGINVLEDMEIREGIKAYSNWPTIPQVYVKGEFVGGCDITREMFQSGELQQLLAERG
FT                   IAVKTAAA"
     MTDINTRIEN EIKSQDVVVF MKGTPQFPMC GFSGQVAQIL NYLGVDYKGI NVLEDMEIRE        60
     GIKAYSNWPT IPQVYVKGEF VGGCDITREM FQSGELQQLL AERGIAVKTA AA               112
//

If you have problems or comments...

PBIL Back to PBIL home page