(data stored in ACNUC7421 zone)

EMBL: CP001349.PE100

CP001349.PE100       Location/Qualifiers
FT   CDS             110557..111354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0105"
FT                   /product="fumarylacetoacetate (FAA) hydrolase"
FT                   /note="PFAM: fumarylacetoacetate (FAA) hydrolase; KEGG:
FT                   bbt:BBta_0175 putative hydratase/decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55152"
FT                   /db_xref="GOA:B8IUA7"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUA7"
FT                   /inference="protein motif:PFAM:PF01557"
FT                   /protein_id="ACL55152.1"
FT                   /translation="MSRLDGPAVAAAAERLWRHWQEGSRLDALPAAERPATRAEGYAIQ
FT                   ARMASLSRAPLFGWKIAATSAAGQAHIGVDGPLAGRLLAERVLDPQEEVPFRGNLMRVA
FT                   EAEIAFRMGQNLPPRAEPYDLASVLAAVDTVHPAIEFPDSRFADFVTAGGPQLIADNAC
FT                   AHLFVLGPPAPEWRDLDLVHLATRASLSGGPDHPGIGANVLGDPRIALVWLVNELSGLG
FT                   ITLQAGQVVTTGTTTVPIPIRPQSSLTADLGPLGRLTVRIGPG"
     MSRLDGPAVA AAAERLWRHW QEGSRLDALP AAERPATRAE GYAIQARMAS LSRAPLFGWK        60
     IAATSAAGQA HIGVDGPLAG RLLAERVLDP QEEVPFRGNL MRVAEAEIAF RMGQNLPPRA       120
     EPYDLASVLA AVDTVHPAIE FPDSRFADFV TAGGPQLIAD NACAHLFVLG PPAPEWRDLD       180
     LVHLATRASL SGGPDHPGIG ANVLGDPRIA LVWLVNELSG LGITLQAGQV VTTGTTTVPI       240
     PIRPQSSLTA DLGPLGRLTV RIGPG                                             265
//

If you have problems or comments...

PBIL Back to PBIL home page