(data stored in ACNUC7421 zone)

EMBL: CP001349.PE101

CP001349.PE101       Location/Qualifiers
FT   CDS             complement(111374..111646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0106"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_4742 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55153"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUA8"
FT                   /inference="similar to AA sequence:KEGG:M446_4742"
FT                   /protein_id="ACL55153.1"
FT                   /translation="MKRSLLLASLVLGTVIAAGSVQAQGIPGGIRRGAAEGDRVAGPIG
FT                   GIVGGAVGGAVGGVNGVLGIDPGRRAYRTSLPGRRHHYRRHRHFR"
     MKRSLLLASL VLGTVIAAGS VQAQGIPGGI RRGAAEGDRV AGPIGGIVGG AVGGAVGGVN        60
     GVLGIDPGRR AYRTSLPGRR HHYRRHRHFR                                         90
//

If you have problems or comments...

PBIL Back to PBIL home page