(data stored in ACNUC7421 zone)

EMBL: CP001349.PE102

CP001349.PE102       Location/Qualifiers
FT   CDS             complement(111795..113156)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0107"
FT                   /product="TRAP-type uncharacterized transport system
FT                   periplasmic component-like protein"
FT                   /note="KEGG: met:M446_4743 TRAP-type uncharacterized
FT                   transport system periplasmic component-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55154"
FT                   /db_xref="GOA:B8IUA9"
FT                   /db_xref="InterPro:IPR011852"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUA9"
FT                   /inference="similar to AA sequence:KEGG:M446_4743"
FT                   /protein_id="ACL55154.1"
FT                   /translation="MRFGRELVFLIGAVLLAGAAGLASYFTRATTLTIAVAPSGGTEPA
FT                   LIRAFADALASQHKSLRLTILPFDGVRESAAALQDGRADLAIVRPDILLPANGLTLAIL
FT                   REQAMIIAAPEPSGIKEMPDLSRKRLAFLAERTTDQAVLQRVLGHYGLALTTDPPPGPL
FT                   APRSVALVPLEEPDLATAFAEKRIDALAILTTPTTPTARRVMRIVQNASRTRKLRLAGV
FT                   AESSALIERFPRLQAVTVAEGLFAGHPKTPEEAVSTIGTSYRLMARSTLSRVAAAEVTQ
FT                   YLFEMRSLLAETVPSANAITAPAYETNAEATSARLPIHPGAIDYYEREQQSFIERYETW
FT                   IYLVAFLGGGVGSAVAWLRQRLSRLRRERIEVATRRLLQIRSEARRTTDRTALEEMAGE
FT                   IDDLAGNIARYALNRPTEAHTMTAATIAIDAARSTVQRALAQSGPPKPTLRAVE"
     MRFGRELVFL IGAVLLAGAA GLASYFTRAT TLTIAVAPSG GTEPALIRAF ADALASQHKS        60
     LRLTILPFDG VRESAAALQD GRADLAIVRP DILLPANGLT LAILREQAMI IAAPEPSGIK       120
     EMPDLSRKRL AFLAERTTDQ AVLQRVLGHY GLALTTDPPP GPLAPRSVAL VPLEEPDLAT       180
     AFAEKRIDAL AILTTPTTPT ARRVMRIVQN ASRTRKLRLA GVAESSALIE RFPRLQAVTV       240
     AEGLFAGHPK TPEEAVSTIG TSYRLMARST LSRVAAAEVT QYLFEMRSLL AETVPSANAI       300
     TAPAYETNAE ATSARLPIHP GAIDYYEREQ QSFIERYETW IYLVAFLGGG VGSAVAWLRQ       360
     RLSRLRRERI EVATRRLLQI RSEARRTTDR TALEEMAGEI DDLAGNIARY ALNRPTEAHT       420
     MTAATIAIDA ARSTVQRALA QSGPPKPTLR AVE                                    453
//

If you have problems or comments...

PBIL Back to PBIL home page