(data stored in ACNUC7421 zone)

EMBL: CP001349.PE103

CP001349.PE103       Location/Qualifiers
FT   CDS             complement(113187..113936)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0108"
FT                   /product="ubiquinone biosynthesis O-methyltransferase"
FT                   /EC_number="2.1.1.64"
FT                   /note="TIGRFAM: ubiquinone biosynthesis
FT                   O-methyltransferase; PFAM: Methyltransferase type 11;
FT                   Methyltransferase type 12; KEGG: met:M446_4744 ubiquinone
FT                   biosynthesis O-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55155"
FT                   /db_xref="GOA:B8IUB0"
FT                   /db_xref="InterPro:IPR010233"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8IUB0"
FT                   /inference="protein motif:TFAM:TIGR01983"
FT                   /protein_id="ACL55155.1"
FT                   /translation="MSETTGPSIDRDEVARFERIAATWWDEAGPMRVLHRFNPVRITYI
FT                   RDTVCRHFGRDPRRPLPLEALSLIDIGCGGGILSEPLARLGATVTGLDPAPTNIRVAQA
FT                   HAAEAGVPVDYRGQTIEAVVEAGERFDVVLAMEVVEHVVDMPAFVRTACAAVKPGGLFF
FT                   AATLNRTMRSFALAIVGAEYVLGWLPRGTHDWEKFVTPAELTGAVESAGLTVIDTTGVV
FT                   YNPLGGRWAMSRDTGVNYMIAAERPVA"
     MSETTGPSID RDEVARFERI AATWWDEAGP MRVLHRFNPV RITYIRDTVC RHFGRDPRRP        60
     LPLEALSLID IGCGGGILSE PLARLGATVT GLDPAPTNIR VAQAHAAEAG VPVDYRGQTI       120
     EAVVEAGERF DVVLAMEVVE HVVDMPAFVR TACAAVKPGG LFFAATLNRT MRSFALAIVG       180
     AEYVLGWLPR GTHDWEKFVT PAELTGAVES AGLTVIDTTG VVYNPLGGRW AMSRDTGVNY       240
     MIAAERPVA                                                               249
//

If you have problems or comments...

PBIL Back to PBIL home page