(data stored in ACNUC7421 zone)

EMBL: CP001349.PE105

CP001349.PE105       Location/Qualifiers
FT   CDS             114128..115363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0110"
FT                   /product="aspartate kinase"
FT                   /EC_number="2.7.2.4"
FT                   /note="TIGRFAM: aspartate kinase; aspartate kinase,
FT                   monofunctional class; PFAM: aspartate/glutamate/uridylate
FT                   kinase; amino acid-binding ACT domain protein; KEGG:
FT                   met:M446_4746 aspartate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55157"
FT                   /db_xref="GOA:B8IUB2"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005260"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR027795"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR041740"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUB2"
FT                   /inference="protein motif:TFAM:TIGR00657"
FT                   /protein_id="ACL55157.1"
FT                   /translation="MPRLVMKFGGTSVATVDRIRNVARHVAREVRAGYEVAVVVSAMAG
FT                   KTNELVAWCKDASPLYAQSEYDAVVASGEQVTSGLLAIVLAEMGIKARSWQGWQIPIET
FT                   SDQHGSARIARIDGSRLDAGFRHGEVAVIAGFQGIHAETGRLTTLGRGGSDTSAVAVAA
FT                   AIGAERCDIYTDVDGVYTTDPRVVPKARRLERVAFEEMLEMASLGAKVLQVRSVELAMV
FT                   HRVPTTVRSSFDDPDDARPGTLICDEDDIVEQQIITGIAFSKDEAQITLRRVKDRPGVA
FT                   AAIFGPLADANINVDMIIQVVSGDGVTTDMTFTVPASDYERARTILDAQSGKVEFERIE
FT                   GATDVVKISAIGVGMRSHAGVAAKAFRALADKGINIRAITTSEIKFSVLIDAAYTELAV
FT                   RTLHSLYGLDRA"
     MPRLVMKFGG TSVATVDRIR NVARHVAREV RAGYEVAVVV SAMAGKTNEL VAWCKDASPL        60
     YAQSEYDAVV ASGEQVTSGL LAIVLAEMGI KARSWQGWQI PIETSDQHGS ARIARIDGSR       120
     LDAGFRHGEV AVIAGFQGIH AETGRLTTLG RGGSDTSAVA VAAAIGAERC DIYTDVDGVY       180
     TTDPRVVPKA RRLERVAFEE MLEMASLGAK VLQVRSVELA MVHRVPTTVR SSFDDPDDAR       240
     PGTLICDEDD IVEQQIITGI AFSKDEAQIT LRRVKDRPGV AAAIFGPLAD ANINVDMIIQ       300
     VVSGDGVTTD MTFTVPASDY ERARTILDAQ SGKVEFERIE GATDVVKISA IGVGMRSHAG       360
     VAAKAFRALA DKGINIRAIT TSEIKFSVLI DAAYTELAVR TLHSLYGLDR A                411
//

If you have problems or comments...

PBIL Back to PBIL home page