(data stored in ACNUC7421 zone)

EMBL: CP001349.PE106

CP001349.PE106       Location/Qualifiers
FT   CDS             115536..117797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0111"
FT                   /product="PTSINtr with GAF domain, PtsP"
FT                   /note="TIGRFAM: phosphoenolpyruvate-protein
FT                   phosphotransferase; PFAM: PEP-utilizing protein; GAF domain
FT                   protein; PEP-utilising protein mobile region; PEP-utilising
FT                   protein domain protein; KEGG: met:M446_4747
FT                   phosphoenolpyruvate-protein phosphotransferase PtsP"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55158"
FT                   /db_xref="GOA:B8IUB3"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR006318"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR008731"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036618"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUB3"
FT                   /inference="protein motif:TFAM:TIGR01417"
FT                   /protein_id="ACL55158.1"
FT                   /translation="MPAAPGGPRLLLRRLREAMAEPVSAQARLDRIVVIIAANMVAEVC
FT                   SVYVLRDDGMLELFATEGLNREAVHLTTMRAGEGLVGLIAASAEPLSLSDAQSHPAFSY
FT                   RPETGEEIYHAFLGVPLLRAGNTMGVLVVQNRTYRVYSEEEIEALQTTAMVLAEMIASG
FT                   DLQALSPGTVNATRRSLSQSGVALAEGVGLGHVVLHEPRIVVKNLIAENVEREVGRLET
FT                   AIAEVRSAIDDLVERGDVAGAGEHREVLETVRMFAHDQGWLRRMREAVLSGLTAEAAVE
FT                   RVQSDNRARMLRQSDPYLRERLHDLDDLANRLLRQLVGAQGMIPGTMPENAILVARSMG
FT                   PAALLDYDRARLRGVVLEEGGPTSHIAIVARALGIPAVGEVANATALVESGDAIIVDGG
FT                   AGEVQIRPGPEVEAAYAEKARLRARRQEQYRALRDLPSVTRDGVGIALQLNAGLLVDLS
FT                   HLNETGAEGVGLFRTELQFMVAERMPSAAEQQSLYEAVFAAAGDLPVTIRTLDIGGDKI
FT                   LPYMKALEEENPALGWRAIRIGLDRPGLLRMQLRALLKAAGGRPLKIMFPMVATVDEFI
FT                   RAKAIVDREKAHLARHGRPLPSDCRLGVMVEVPSLLFQMDEIAAAADFLSVGSNDLMQF
FT                   LFAVDRENRQVANRFDPLCAAALRAFGLIAERAQAAGTPVTVCGEIGGRPLEAMALIGL
FT                   GYRALSMSPASIGPVKAMVLSLDAAKIGAFLRDELAKTSDGASLRPALAAYAEAHGIPV
FT                   "
     MPAAPGGPRL LLRRLREAMA EPVSAQARLD RIVVIIAANM VAEVCSVYVL RDDGMLELFA        60
     TEGLNREAVH LTTMRAGEGL VGLIAASAEP LSLSDAQSHP AFSYRPETGE EIYHAFLGVP       120
     LLRAGNTMGV LVVQNRTYRV YSEEEIEALQ TTAMVLAEMI ASGDLQALSP GTVNATRRSL       180
     SQSGVALAEG VGLGHVVLHE PRIVVKNLIA ENVEREVGRL ETAIAEVRSA IDDLVERGDV       240
     AGAGEHREVL ETVRMFAHDQ GWLRRMREAV LSGLTAEAAV ERVQSDNRAR MLRQSDPYLR       300
     ERLHDLDDLA NRLLRQLVGA QGMIPGTMPE NAILVARSMG PAALLDYDRA RLRGVVLEEG       360
     GPTSHIAIVA RALGIPAVGE VANATALVES GDAIIVDGGA GEVQIRPGPE VEAAYAEKAR       420
     LRARRQEQYR ALRDLPSVTR DGVGIALQLN AGLLVDLSHL NETGAEGVGL FRTELQFMVA       480
     ERMPSAAEQQ SLYEAVFAAA GDLPVTIRTL DIGGDKILPY MKALEEENPA LGWRAIRIGL       540
     DRPGLLRMQL RALLKAAGGR PLKIMFPMVA TVDEFIRAKA IVDREKAHLA RHGRPLPSDC       600
     RLGVMVEVPS LLFQMDEIAA AADFLSVGSN DLMQFLFAVD RENRQVANRF DPLCAAALRA       660
     FGLIAERAQA AGTPVTVCGE IGGRPLEAMA LIGLGYRALS MSPASIGPVK AMVLSLDAAK       720
     IGAFLRDELA KTSDGASLRP ALAAYAEAHG IPV                                    753
//

If you have problems or comments...

PBIL Back to PBIL home page