(data stored in ACNUC7421 zone)

EMBL: CP001349.PE107

CP001349.PE107       Location/Qualifiers
FT   CDS             117995..119074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0112"
FT                   /product="peptide chain release factor 1"
FT                   /note="TIGRFAM: peptide chain release factor 1; PFAM: Class
FT                   I peptide chain release factor; PCRF domain protein; KEGG:
FT                   met:M446_4748 peptide chain release factor 1"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55159"
FT                   /db_xref="GOA:B8IUB4"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004373"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8IUB4"
FT                   /inference="protein motif:TFAM:TIGR00019"
FT                   /protein_id="ACL55159.1"
FT                   /translation="MIAIPSDRLDAILARHDIVTATLSAGEADSESFVQLSRELSDLDD
FT                   VVAAIRAYRAADAELRGVEAMLEEGDPEMRALAAEEKPEVEAARDAAAKALQILLLPKD
FT                   SADEKSAILEIRAGTGGDEAALFAGDLFRMYARYADLKGWKVEVVSESPGTMGGYREVV
FT                   AEVKGRGVFARLKFESGAHRVQRVPETETQGRIHTSAATVAVLPEAEEVDIHVNEADLK
FT                   IDTMRAQGAGGQHVNKTESAIRITHMPSGIVVFVQEERSQHKNRARAMAVLRARLYEQE
FT                   RSQKDAARAADRRAQVGSGDRSERIRTYNFPQGRVTDHRINLTLYKLEEVLAGTALDEL
FT                   VDALVTEHQAALLAAEGLG"
     MIAIPSDRLD AILARHDIVT ATLSAGEADS ESFVQLSREL SDLDDVVAAI RAYRAADAEL        60
     RGVEAMLEEG DPEMRALAAE EKPEVEAARD AAAKALQILL LPKDSADEKS AILEIRAGTG       120
     GDEAALFAGD LFRMYARYAD LKGWKVEVVS ESPGTMGGYR EVVAEVKGRG VFARLKFESG       180
     AHRVQRVPET ETQGRIHTSA ATVAVLPEAE EVDIHVNEAD LKIDTMRAQG AGGQHVNKTE       240
     SAIRITHMPS GIVVFVQEER SQHKNRARAM AVLRARLYEQ ERSQKDAARA ADRRAQVGSG       300
     DRSERIRTYN FPQGRVTDHR INLTLYKLEE VLAGTALDEL VDALVTEHQA ALLAAEGLG        359
//

If you have problems or comments...

PBIL Back to PBIL home page