(data stored in ACNUC7421 zone)

EMBL: CP001349.PE108

CP001349.PE108       Location/Qualifiers
FT   CDS             119071..119970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0113"
FT                   /product="modification methylase, HemK family"
FT                   /note="TIGRFAM: modification methylase, HemK family; PFAM:
FT                   putative RNA methylase; methyltransferase small; KEGG:
FT                   met:M446_4749 protein-(glutamine-N5) methyltransferase,
FT                   release factor-specific"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55160"
FT                   /db_xref="GOA:B8IUB5"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004556"
FT                   /db_xref="InterPro:IPR019874"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR040758"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUB5"
FT                   /inference="protein motif:TFAM:TIGR00536"
FT                   /protein_id="ACL55160.1"
FT                   /translation="MSEPVRAGLSRAAAQSHAAAFLAGRGIATAMRDARLLLIETLNLR
FT                   SIDLVLAGDRELEAREAARLSAALLRRAEGEPVARILGAWEFWGLPFRLSPATLVPRPD
FT                   TETVVEAALALGLERTAPIRLLDLGTGSGCLLVALLSEWPCATGLGIDRAREALVTARD
FT                   NADQNGVGARALWVQGDWAGSLRGPFDVIVANPPYIASRMIDGLADEVRVHDPRMALDG
FT                   GSDGLDAYRVILGQAAVLLAPGGRLIVEIGYDQEEALRHLAEAARLQVVVVRRDLAGHP
FT                   RAVVMAREPGRNPDSSGF"
     MSEPVRAGLS RAAAQSHAAA FLAGRGIATA MRDARLLLIE TLNLRSIDLV LAGDRELEAR        60
     EAARLSAALL RRAEGEPVAR ILGAWEFWGL PFRLSPATLV PRPDTETVVE AALALGLERT       120
     APIRLLDLGT GSGCLLVALL SEWPCATGLG IDRAREALVT ARDNADQNGV GARALWVQGD       180
     WAGSLRGPFD VIVANPPYIA SRMIDGLADE VRVHDPRMAL DGGSDGLDAY RVILGQAAVL       240
     LAPGGRLIVE IGYDQEEALR HLAEAARLQV VVVRRDLAGH PRAVVMAREP GRNPDSSGF        299
//

If you have problems or comments...

PBIL Back to PBIL home page